PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008240722.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family B3
Protein Properties Length: 456aa    MW: 52362.6 Da    PI: 8.3159
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008240722.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B336.68.3e-12221061099
                     HHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3  10 vlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                     ++k+ r+ +p kf++++g++   s  + l+ +sg ++e++l+ r ++g++++ kGW eF k   L+ g ++vF ++g+s+f   v +f+k
  XP_008240722.1  22 TSKKTRIKIPMKFLTRYGEN--LSSPVHLKLPSGLEMEIELR-RSNDGWVWFDKGWPEFSKLCSLDYGNSLVFGYEGNSNF--SVFIFDK 106
                     567789***********977..6667***************3.666677****************************9999..7777776 PP

2B353.35e-17199278789
                     .-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
              B3   7 psdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                     ++ +  +g l lp +fa++h ++k++ + ++l+ ++gr+W v+++y+ +   + +++GW  F+++n+Lk+gD++vF l++ +e
  XP_008240722.1 199 QPVYIHRGYLHLPSEFARRH-LVKQRARNIILKILDGRTWVVEFKYETSI--TRFQRGWLAFARDNNLKVGDVCVFVLIDCNE 278
                     555667889***********.45567789***************555554..669**********************986333 PP

3B349.67.2e-163764551698
                     EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3  16 lvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                     l +p +fa+++ +k  +++t+ l+  + rsW v+li   k ++  l +GW+eFv +n L egD+++F+l++r++  l+v++fr
  XP_008240722.1 376 LHVPVTFARSFVKK--RKQTVNLQV-RERSWPVNLIGHTKESGAKLCGGWREFVTENCLMEGDVCIFELIERNDIVLKVHIFR 455
                     789*****999755..445788665.88*******9877777788999**********************999999****997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.105.7E-179107IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019369.22E-179107IPR015300DNA-binding pseudobarrel domain
CDDcd100171.41E-812105No hitNo description
PROSITE profilePS5086311.15213107IPR003340B3 DNA binding domain
SMARTSM010194.3E-514107IPR003340B3 DNA binding domain
PfamPF023622.9E-922106IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.6E-21186287IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.55E-22187288IPR015300DNA-binding pseudobarrel domain
CDDcd100172.16E-20192287No hitNo description
PROSITE profilePS5086314.48193289IPR003340B3 DNA binding domain
SMARTSM010191.4E-13194287IPR003340B3 DNA binding domain
PfamPF023625.7E-15198279IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.6E-20358455IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.92E-18358455IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.196361456IPR003340B3 DNA binding domain
CDDcd100171.34E-16363455No hitNo description
SMARTSM010192.0E-10365455IPR003340B3 DNA binding domain
PfamPF023625.9E-14376455IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    Send to blast
MASLHDSPAS IPHFLRIILD KTSKKTRIKI PMKFLTRYGE NLSSPVHLKL PSGLEMEIEL  60
RRSNDGWVWF DKGWPEFSKL CSLDYGNSLV FGYEGNSNFS VFIFDKTATE IEYPKPEMEE  120
TDSDSEEDDD DDDDDESGHA RGEIKRENDM PTKKDFGGSS SSRIFLGRMH PLTKSEKALA  180
LQRANAFESE YPSFLVAIQP VYIHRGYLHL PSEFARRHLV KQRARNIILK ILDGRTWVVE  240
FKYETSITRF QRGWLAFARD NNLKVGDVCV FVLIDCNERL FEVFFYRTNN AEDCPLSPGH  300
GGVAIDRVEK RRNPMIKVET DCTTNYENGK YKRLKTGGQV TQRPLNSSSR SLEAANRFTP  360
KNPSFRATLG STPLILHVPV TFARSFVKKR KQTVNLQVRE RSWPVNLIGH TKESGAKLCG  420
GWREFVTENC LMEGDVCIFE LIERNDIVLK VHIFRC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A3e-1816745522143B3 domain-containing transcription factor VRN
4i1k_B3e-1816745522143B3 domain-containing transcription factor VRN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3249237e-45AF324923.1 Prunus armeniaca microsatellite ssrPaCITA13 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008240722.10.0PREDICTED: B3 domain-containing transcription factor VRN1-like
TrEMBLM5VSN91e-124M5VSN9_PRUPE; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF9834369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49475.12e-20B3 family protein